PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G207200.2
Common NameB456_009G207200, LOC105769154
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 332aa    MW: 36860.4 Da    PI: 9.4755
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G207200.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17.4e-32133186255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Gorai.009G207200.2 133 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 186
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.61E-15130187IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-28131187IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-23133186IPR006447Myb domain, plants
PfamPF002492.1E-7134185IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MFLSSNTIMR TAPFPDLSLQ ISPPSVSDCK AKEMAYDVLS GKSIYSDRSS TTDSGSSGSD  60
LSHENGYINP GLGEPTLSLG FEMADLGPPH LQQPRNPHHL HQQHHYQPQI YGRDFKRSAR  120
TMNGGVKRSI RAPRMRWTTT LHAHFVHAVQ LLGGHERATP KSVLELMNVK DLTLAHVKSH  180
LQMYRTVKST DKGSGQGQTD MSLNQRVGIF DLDGRLSSPK ADRNASYSLK LSTPSPQTIP  240
QRTQSDSWPS SMETNNFRVS NRGNGLTFKP NDTKVDGDKA VLHMSDRMKE RLDSSSMSPS  300
DMFLNLEITL GRPSWQMDYA ESSNELTLLK C*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2719891e-106KP271989.1 UNVERIFIED: Populus trichocarpa isolate Potri.014G037200_BESC-125 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012445063.10.0PREDICTED: probable transcription factor KAN4
TrEMBLA0A0D2QJW00.0A0A0D2QJW0_G
STRINGVIT_18s0001g11390.t011e-133(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.11e-68G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]